SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000422735 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000422735
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.07e-22
Family FAD-linked reductases, N-terminal domain 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422735   Gene: ENSG00000171503   Transcript: ENST00000507475
Sequence length 164
Comment pep:putative chromosome:GRCh38:4:158672307:158699002:1 gene:ENSG00000171503 transcript:ENST00000507475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNHGNYIVRLGHLVSWMGEQAEALGVEVYPGYAAAEVLFHDDGSVKGIATNDVGIQKDG
APKATFERGLELHAKVTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKN
WKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVALGLVVGLDY
Download sequence
Identical sequences A0A2J8MV27 A0A2J8W073 D6RAD5
ENSP00000422735 ENSP00000422735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]