SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000422826 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000422826
Domain Number 1 Region: 33-127
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.000000981
Family Integrin alpha N-terminal domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422826   Gene: ENSG00000005884   Transcript: ENST00000506401
Sequence length 142
Comment pep:known chromosome:GRCh38:17:50055968:50076995:1 gene:ENSG00000005884 transcript:ENST00000506401 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGPGPSRAPRAPRLMLCALALMVAAGGCVVSAFNLDTRFLVVKEAGNPGSLFGYSVALHR
QTERQQRYLLLAGAPRELAVPDGYTNRTGAVYLCPLTAHKDDCERMNITVKNDPGHHIIE
DMWLGVTVASQGPAGRVLETAT
Download sequence
Identical sequences D6R9X8
ENSP00000422826 ENSP00000422826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]