SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000422905 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000422905
Domain Number 1 Region: 95-271
Classification Level Classification E-value
Superfamily Sec7 domain 4.97e-46
Family Sec7 domain 0.0000983
Further Details:      
 
Weak hits

Sequence:  ENSP00000422905
Domain Number - Region: 57-98
Classification Level Classification E-value
Superfamily F-box domain 0.00159
Family F-box domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000422905   Gene: ENSG00000164117   Transcript: ENST00000503293
Sequence length 278
Comment pep:novel chromosome:GRCh38:4:174236969:174283667:-1 gene:ENSG00000164117 transcript:ENST00000503293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKDL
ANDELLWQGLCKSTWGHCSIYNKNPPLGFSFRKLYMQLDEGSLTFNANPDEGVNYFMSKG
ILDDSPKEIAKFIFCTRTLNWKKLRIYLDERRDVLDDLVTLHNFRNQFLPNALREFFRHI
HAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCYSLILLSIDLTSPHVKN
KMSKREFIRNTRRAAQNISEDFVGHLYDNIYLIGHVAA
Download sequence
Identical sequences A0A2I2ZYC6 A0A2I3HA98 A0A2I3TQ15 A0A2J8STG6
ENSP00000422905 XP_012363680.1.23891 ENSP00000422905 ENSP00000484517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]