SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000423235 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423235
Domain Number 1 Region: 3-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.76e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423235   Gene: ENSG00000089335   Transcript: ENST00000505365
Sequence length 131
Comment pep:novel chromosome:GRCh38:19:34677836:34686396:1 gene:ENSG00000089335 transcript:ENST00000505365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQVTFSDVAIDFSHEEWACLDSAQRDLYKDVMVQNYENLVSVGLSVTKPYVIMLLEDGK
EPWMMEKKLSKAYPFPLSHSVPASVNFGFSALFEHCSEVTEIFELSELCVFWVLHFLSNS
PNSTVEAFFKK
Download sequence
Identical sequences D6R9Q0
NP_001276119.1.87134 NP_001276119.1.92137 NP_001276120.1.87134 NP_001276120.1.92137 NP_001276121.1.87134 NP_001276121.1.92137 NP_061145.2.87134 NP_061145.2.92137 ENSP00000423235 ENSP00000423235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]