SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000423467 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000423467
Domain Number 1 Region: 4-45
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.0000000596
Family Inorganic pyrophosphatase 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000423467   Gene: ENSG00000138777   Transcript: ENST00000509031
Sequence length 63
Comment pep:known chromosome:GRCh38:4:105369561:105474014:-1 gene:ENSG00000138777 transcript:ENST00000509031 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MALYHTEERGQPCSQNYRLFFKNVTGHYISPFHDIPLKVNSKEDTEAQGIFIDLSKIWKM
AFL
Download sequence
Identical sequences A0A0C4DGB9 A0A2J8M2T2 A0A2J8XQL3
ENSP00000423467 ENSP00000423467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]