SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000424265 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000424265
Domain Number 1 Region: 130-239
Classification Level Classification E-value
Superfamily Tumor suppressor gene product Apc 4.32e-46
Family Tumor suppressor gene product Apc 0.000000863
Further Details:      
 
Domain Number 2 Region: 3-54
Classification Level Classification E-value
Superfamily N-terminal coiled coil domain from apc 1.44e-23
Family N-terminal coiled coil domain from apc 0.0000716
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000424265   Gene: ENSG00000134982   Transcript: ENST00000508624
Sequence length 287
Comment pep:known chromosome:GRCh38:5:112737885:112842755:1 gene:ENSG00000134982 transcript:ENST00000508624 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM
ASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPR
RGFVNGSRESTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL
QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRIARIQQIEKDILRIRQLLQSQAT
EAERSSQNKHETGSHDAERQNEGQGVGEINMATSGNGQIEKMRMFEC
Download sequence
Identical sequences E7EMH9
ENSP00000424265 ENSP00000424265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]