SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000424393 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000424393
Domain Number 1 Region: 16-119
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 4.45e-19
Family Calcium ATPase, transduction domain A 0.0016
Further Details:      
 
Domain Number 2 Region: 122-191
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000000000719
Family Calcium ATPase, transmembrane domain M 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000424393   Gene: ENSG00000159363   Transcript: ENST00000506174
Sequence length 191
Comment pep:novel chromosome:GRCh38:1:16996087:17000312:-1 gene:ENSG00000159363 transcript:ENST00000506174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSQTLRDMVKLSMRVCVCRPGGEEEWVDSSELVPGDCLVLPQEGGLMPCDAALVAGECMV
NESSLTGESIPVLKTALPEGLGPYCAETHRRHTLFCGTLILQARAYVGPHVLAVVTRTGG
LVSSILHPRPINFKFYKHSMKFVAALSVLALLGTIYSIFILYRNRVPLNEIVIRALDLVT
VVVPPALPAAM
Download sequence
Identical sequences A0A2J8KEI4 H0Y9K4
ENSP00000424393 ENSP00000424393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]