SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000424870 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000424870
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily SRP19 6.15e-39
Family SRP19 0.000000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000424870   Gene: ENSG00000153037   Transcript: ENST00000505459
Sequence length 144
Comment pep:known chromosome:GRCh38:5:112861222:112869788:1 gene:ENSG00000153037 transcript:ENST00000505459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNV
FLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQ
KTGGADQSLQQGEGSKKGKGKKKK
Download sequence
Identical sequences A0A2J8XF16 H2QRB6 P09132 Q5RBR1
ENSP00000282999 ENSNLEP00000014071 ENSNLEP00000014071 ENSPTRP00000029328 ENSPTRP00000029328 ENSP00000424870 ENSP00000424870 NP_001229349.1.37143 NP_003126.1.87134 NP_003126.1.92137 XP_003259879.1.23891 XP_008950325.1.60992 gi|4507213|ref|NP_003126.1| 9598.ENSPTRP00000029328 9606.ENSP00000282999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]