SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000424899 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000424899
Domain Number 1 Region: 3-123
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.98e-23
Family G proteins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000424899   Gene: ENSG00000157869   Transcript: ENST00000511649
Sequence length 143
Comment pep:putative chromosome:GRCh38:4:13361354:13474345:-1 gene:ENSG00000157869 transcript:ENST00000511649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLDKYIYGAQGVLLVYDITNYQSFENLEDWYTVVKKVSEESETQPLVALVGNKIDLEHMR
TIKPEKHLRFCQENGFSSHFVSAKTGDSVFLCFQKVAAEILGIKLNKAEIEQSQRIVRAE
IVKYPEEENQHTTSTQSRICSVQ
Download sequence
Identical sequences H0Y9S6
ENSP00000424899 ENSP00000424899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]