SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000424949 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000424949
Domain Number 1 Region: 12-49
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000228
Family THAP domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000424949   Gene: ENSG00000174796   Transcript: ENST00000507557
Sequence length 89
Comment pep:putative chromosome:GRCh38:4:75514444:75544440:1 gene:ENSG00000174796 transcript:ENST00000507557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLDVNAAGIWEPKKGDVLCSRHFKKTDFDRSAPNIKLKPGVIPSIFDSPYHLQISMFK
RKCLFKAKNYFSVTIIANIYKVPIFIQST
Download sequence
Identical sequences D6REQ5
ENSP00000424949 ENSP00000424949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]