SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425268 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000425268
Domain Number - Region: 46-76
Classification Level Classification E-value
Superfamily Ribosomal protein S18 0.0314
Family Ribosomal protein S18 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425268   Gene: ENSG00000163319   Transcript: ENST00000505719
Sequence length 92
Comment pep:putative chromosome:GRCh38:4:83456090:83461328:1 gene:ENSG00000163319 transcript:ENST00000505719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLPISMENPYKEPLKK
CILCGKHVDYKNVQVFVGRNRKKSQKQLRELK
Download sequence
Identical sequences A0A2J8PGE9 H0Y9W2
ENSP00000425268 ENSP00000425268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]