SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425512 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425512
Domain Number 1 Region: 2-249
Classification Level Classification E-value
Superfamily Kelch motif 1.11e-78
Family Kelch motif 0.00000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425512   Gene: ENSG00000109790   Transcript: ENST00000515612
Sequence length 282
Comment pep:known chromosome:GRCh38:4:39103315:39126857:1 gene:ENSG00000109790 transcript:ENST00000515612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XRTNMWTPVANMNGRRLQFGVAVLDDKLYVVGGRDGLKTLNTVECYNPKTKTWSVMPPMS
THRHGLGVAVLEGPMYAVGGHDGWSYLNTVERWDPQARQWNFVATMSTPRSTVGVAVLSG
KLYAVGGRDGSSCLKSVECFDPHTNKWTLCAQMSKRRGGVGVTTWNGLLYAIGGHDAPAS
NLTSRLSDCVERYDPKTDMWTAVASMSISRDAVGVCLLGDKLYAVGGYDGQAYLNTVEAY
DPQTNEWTQVFSHTFEDSKDHLVAIKQTIWRQNSLSEEFRSH
Download sequence
Identical sequences H0Y9Y5
ENSP00000425512 ENSP00000425512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]