SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425548 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425548
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000016
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425548   Gene: ENSG00000114547   Transcript: ENST00000513830
Sequence length 130
Comment pep:known chromosome:GRCh38:3:125969194:125977160:1 gene:ENSG00000114547 transcript:ENST00000513830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVRERSERVA
LCNWAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWL
KFLALACSAL
Download sequence
Identical sequences D6RCR2
ENSP00000425548 ENSP00000425548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]