SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425695 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425695
Domain Number 1 Region: 62-181
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.61e-30
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425695   Gene: ENSG00000112855   Transcript: ENST00000509299
Sequence length 181
Comment pep:putative chromosome:GRCh38:5:140691453:140695634:1 gene:ENSG00000112855 transcript:ENST00000509299 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLGLLPRRAWASLLSQLLRPPCASCTGAVRCQSQGEESLQVAEAVLTSQLKAHQEKPN
FIIKTPKGTRDLSPQHMVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGEDSGL
MYDLKDQGGELLSLRYDLTVPFARYLAMNKVKKMKRYHVGKVWRRESPTIVQGRYREFCQ
C
Download sequence
Identical sequences A0A2J8JIV3 D6RJE6
ENSP00000425695 ENSP00000425695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]