SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000425980 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000425980
Domain Number 1 Region: 2-83
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.22e-21
Family Integrin alpha N-terminal domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000425980   Gene: ENSG00000005884   Transcript: ENST00000510809
Sequence length 84
Comment pep:known chromosome:GRCh38:17:50072160:50075700:1 gene:ENSG00000005884 transcript:ENST00000510809 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XINQDGFQDIAVGAPFEGLGKVYIYHSSSKGLLRQPQQVIHGEKLGLPGLATFGYSLSGQ
MDVDENFYPDLLVGSLSDHIVLLR
Download sequence
Identical sequences H0YA32
ENSP00000425980 ENSP00000425980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]