SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000426271 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426271
Domain Number 1 Region: 6-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000418
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426271   Gene: ENSG00000114547   Transcript: ENST00000514116
Sequence length 212
Comment pep:known chromosome:GRCh38:3:125969144:125983454:1 gene:ENSG00000114547 transcript:ENST00000514116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVRERSERVA
LCNWAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWL
KFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHV
SRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
Download sequence
Identical sequences A0A140VKG6 Q9BZX4
9606.ENSP00000251776 ENSP00000251776 ENSP00000426271 NP_001012337.1.87134 NP_001012337.1.92137 NP_001295242.1.87134 NP_001295242.1.92137 XP_006713576.1.92137 ENSP00000251776 gi|59891409|ref|NP_001012337.1| ENSP00000251776 ENSP00000426271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]