SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000426424 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426424
Domain Number 1 Region: 24-116
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 1.97e-17
Family Interleukin 8-like chemokines 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426424   Gene: ENSG00000151882   Transcript: ENST00000489442
Sequence length 127
Comment pep:known chromosome:GRCh38:5:43376645:43412375:-1 gene:ENSG00000151882 transcript:ENST00000489442 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MQQRGLAIVALAVCAALHASEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDL
AAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHET
YGHKTPY
Download sequence
Identical sequences A0A2I3SGU5 A0N0Q3 Q9NRJ3
9598.ENSPTRP00000041448 9606.ENSP00000354416 ENSP00000354416 gi|22538811|ref|NP_683513.1| ENSPTRP00000041448 ENSP00000354416 ENSP00000426424 ENSP00000354416 ENSP00000426424 NP_001288802.1.87134 NP_001288802.1.92137 NP_001288803.1.87134 NP_001288803.1.92137 NP_683513.1.87134 NP_683513.1.92137 XP_003811048.1.60992 ENSPTRP00000041448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]