SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000426741 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426741
Domain Number 1 Region: 27-165
Classification Level Classification E-value
Superfamily Cupredoxins 1.76e-47
Family Ephrin ectodomain 0.0000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426741   Gene: ENSG00000251246   Transcript: ENST00000505139
Sequence length 233
Comment pep:putative chromosome:GRCh38:1:155063748:155086807:1 gene:ENSG00000251246 transcript:ENST00000505139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPSLRREGYTVQVNVNDYLDIYCPH
YNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEK
FQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFT
MGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Download sequence
Identical sequences B4DXG7 G3RDG8
ENSP00000426741 ENSNLEP00000014368 XP_004026913.2.27298 ENSP00000426741 ENSP00000450814 ENSP00000426741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]