SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000426989 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000426989
Domain Number 1 Region: 29-163
Classification Level Classification E-value
Superfamily Cupredoxins 8.51e-53
Family Ephrin ectodomain 0.0000000944
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000426989   Gene: ENSG00000184349   Transcript: ENST00000509503
Sequence length 201
Comment pep:novel chromosome:GRCh38:5:107381238:107670627:-1 gene:ENSG00000184349 transcript:ENST00000509503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNDTVHESAEPSRGENAAQT
PRIPSRLLAILLFLLAMLLTL
Download sequence
Identical sequences A0A286Y379 A0A2I3GCC7 A0A2I3SW52 A0A2J8XEZ5 A0A2K5QSS4 A0A2K6GUR1 A0A2K6V1I2 D6RDV5 G3SHR8
ENSP00000426989 ENSP00000426989 XP_003463587.1.53824 XP_004778321.1.14098 XP_006714628.1.92137 XP_006927926.1.62641 XP_008504844.1.77740 XP_008950354.1.60992 XP_009447714.1.37143 XP_010338305.1.74449 XP_010606906.1.5607 XP_014708464.1.49734 XP_017382726.1.71028 XP_018884019.1.27298 XP_019306081.1.44245 XP_021557191.1.83697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]