SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000427014 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427014
Domain Number 1 Region: 49-98
Classification Level Classification E-value
Superfamily Ribosomal protein S18 6.54e-19
Family Ribosomal protein S18 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427014   Gene: ENSG00000163319   Transcript: ENST00000509970
Sequence length 113
Comment pep:putative chromosome:GRCh38:4:83456083:83467504:1 gene:ENSG00000163319 transcript:ENST00000509970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XAVVAVCGGLGRKKLTHLVTAAVSLTHPGTHTVLWRRGCSQQVSSNEDLLLSQFVSPFTG
CIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKDPAYLKDPKVCNIRYRE
Download sequence
Identical sequences H0YAG5
ENSP00000427014 ENSP00000427014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]