SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000427375 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427375
Domain Number 1 Region: 2-57
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.09e-18
Family Inorganic pyrophosphatase 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427375   Gene: ENSG00000138777   Transcript: ENST00000515567
Sequence length 69
Comment pep:novel chromosome:GRCh38:4:105369565:105449371:-1 gene:ENSG00000138777 transcript:ENST00000515567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XWTNAKMEIATKEPMNPIKQYVKDGKLRYVANIFPYKGYIWNYGTLPQVSSSPNKESNEE
EQVWHFLGK
Download sequence
Identical sequences H0YAK2
ENSP00000427375 ENSP00000427375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]