SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000427438 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427438
Domain Number 1 Region: 315-567
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.14e-68
Family Eukaryotic proteases 0.0016
Further Details:      
 
Domain Number 2 Region: 110-219
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-19
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0075
Further Details:      
 
Domain Number 3 Region: 258-294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000144
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 4 Region: 224-256
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000117
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 5 Region: 46-106
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000576
Family Ovomucoid domain III-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427438   Gene: ENSG00000205403   Transcript: ENST00000512148
Sequence length 576
Comment pep:known chromosome:GRCh38:4:109740724:109801985:-1 gene:ENSG00000205403 transcript:ENST00000512148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLHVFLLFLCFHLRFCKVTYTSQEDLVEKKCLAKKYTHLSCDKVFCQPWQRCIEGTCV
CKLPYQCPKNGTAVCATNRRSFPTYCQQKSLECLHPGTKFLNNGTCTAEGKFSVSLKHGN
TDSEGIVEVKLVDQDKTMFICKSSWSMREANVACLDLGFQQGADTQRRFKLSDLSINSTE
CLHVHCRGLETSLAECTFTKRRTMGYQDFADVVCYTQKADSPMDDFFQCVNGKYISQMKA
CDGINDCGDQSDELCCKACQGKGFHCKSGVCIPSQYQCNGEVDCITGEDEVGCAEETEIL
TADMDAERRRIKSLLPKLSCGVKNRMHIRRKRIVGGKRAQLGDLPWQVAIKDASGITCGG
IYIGGCWILTAAHCLRASKTHRYQIWTTVVDWIHPDLKRIVIEYVDRIIFHENYNAGTYQ
NDIALIEMKKDGNKKDCELPRSIPACVPWSPYLFQPNDTCIVSGWGREKDNERVFSLQWG
EVKLISNCSKFYGNRFYEKEMECAGTYDGSIDACKGDSGGPLVCMDANNVTYVWGVVSWG
ENCGKPEFPGVYTKVANYFDWISYHVGRPFISQYNV
Download sequence
Identical sequences G3XAM2
ENSP00000427438 ENSP00000427438 XP_005263033.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]