SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000427506 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427506
Domain Number 1 Region: 61-139
Classification Level Classification E-value
Superfamily F-box domain 1.83e-16
Family F-box domain 0.0023
Further Details:      
 
Domain Number 2 Region: 132-183
Classification Level Classification E-value
Superfamily Sec7 domain 0.0000000222
Family Sec7 domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427506   Gene: ENSG00000164117   Transcript: ENST00000513696
Sequence length 184
Comment pep:known chromosome:GRCh38:4:174241123:174283663:-1 gene:ENSG00000164117 transcript:ENST00000513696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKAR
KSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCS
IYNKNPPLGFSFRKLYMQLDEGSLTFNANPDEGVNYFMSKGILDDSPKEIAKFIFCTRTL
NWKK
Download sequence
Identical sequences A0A2J8STF4 D6RIC0
ENSP00000427506 ENSP00000427506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]