SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000427897 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000427897
Domain Number 1 Region: 21-88
Classification Level Classification E-value
Superfamily Sec7 domain 0.0000000000000122
Family Sec7 domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000427897   Gene: ENSG00000156011   Transcript: ENST00000521027
Sequence length 119
Comment pep:putative chromosome:GRCh38:8:18802276:18804874:-1 gene:ENSG00000156011 transcript:ENST00000521027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XLEAHSEMGSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQLDRFKRSDVAKHLGKNNE
FSKLVAEEYLKFFDFTGMTLDQSLRVSLCHPGWSAVAPSWLTATSTSQVQAVLLNQPPE
Download sequence
Identical sequences H0YAQ7
ENSP00000427897 ENSP00000427897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]