SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000428375 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428375
Domain Number 1 Region: 57-118
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 3.27e-17
Family AN1-like Zinc finger 0.0000458
Further Details:      
 
Domain Number 2 Region: 6-53
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000000615
Family AN1-like Zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428375   Gene: ENSG00000104231   Transcript: ENST00000519464
Sequence length 165
Comment pep:known chromosome:GRCh38:8:81702544:81721287:-1 gene:ENSG00000104231 transcript:ENST00000519464 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MAELDIGQHCQVEHCRQRDFLPFVCDDCSGIFCLEHRSRESHGCPEVTVINERLKTDQHT
SYPCSFKDCAERELVAVICPYCEKNFCLRHRHQSDHECEKLEIPKPRMAATQKLVKDIID
SKTGETASKRWKGAKNSETAAKVALMKLKMHADGDKSLPQMSNLE
Download sequence
Identical sequences E5RIS3
ENSP00000428375 ENSP00000428375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]