SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000428840 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428840
Domain Number 1 Region: 48-180
Classification Level Classification E-value
Superfamily PABC (PABP) domain 6.02e-54
Family PABC (PABP) domain 0.00000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428840   Gene: ENSG00000070756   Transcript: ENST00000522658
Sequence length 183
Comment pep:known chromosome:GRCh38:8:100704114:100706974:-1 gene:ENSG00000070756 transcript:ENST00000522658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRPAAPRPPFSTMRPASSQVPRVMSTQRVANTSTQTMGPRPAAAAAAATPAVRTVPQYKY
AAGVRNPQQHLNAQPQVTMQQPAVHVQGQEPLTASMLASAPPQEQKQMLGERLFPLIQAM
HPTLAGKITGMLLEIDNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGV
PTV
Download sequence
Identical sequences A0A2J8PMG9 A0A2J8UFG0 H0YB75
ENSP00000428840 ENSP00000428840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]