SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000428889 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000428889
Domain Number 1 Region: 38-161
Classification Level Classification E-value
Superfamily Sec7 domain 3.53e-41
Family Sec7 domain 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000428889   Gene: ENSG00000156011   Transcript: ENST00000518315
Sequence length 167
Comment pep:known chromosome:GRCh38:8:18535637:18808832:-1 gene:ENSG00000156011 transcript:ENST00000518315 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGSSWCLYGCCNAGVKTTRLEAHSEMGSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQ
LDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRYFFKAFSLVGETQERER
VLIHFSNRYFYCNPDTIASQDGVHCLTCAIMLLNTDLHGHRWWLLQP
Download sequence
Identical sequences A0A2J8X457 E5RFG7
ENSP00000428889 ENSP00000428889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]