SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429093 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429093
Domain Number 1 Region: 12-243
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.22e-93
Family CAF1-like ribonuclease 0.000000000662
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429093   Gene: ENSG00000198791   Transcript: ENST00000523917
Sequence length 244
Comment pep:known chromosome:GRCh38:8:17231570:17246878:-1 gene:ENSG00000198791 transcript:ENST00000523917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADY
QYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSG
IQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELD
FFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFK
MREV
Download sequence
Identical sequences A0A093IS70 A0A2J8X3T8 A0A2K5WJX5 A0A2K6GQQ7 F6W2A8 H9ENJ6 K7B4L8
ENSP00000429093 gi|85067505|ref|NP_473367.2| ENSCJAP00000049224 NP_001309016.1.87134 NP_001309016.1.92137 NP_001309017.1.87134 NP_001309017.1.92137 NP_001309018.1.87134 NP_001309018.1.92137 NP_473367.2.87134 NP_473367.2.92137 XP_005398391.1.28644 XP_007612537.1.69978 XP_012518478.1.63892 XP_013207483.1.66349 XP_015000278.1.72884 XP_015309963.1.63531 XP_015316319.1.76553 XP_016814623.1.37143 XP_016829371.1.28591 XP_017194392.1.1745 XP_017509481.1.32401 XP_019520319.1.44202 XP_020037581.1.5219 XP_021482850.1.76796 ENSP00000429093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]