SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429102 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429102
Domain Number 1 Region: 8-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000314
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429102   Gene: ENSG00000165084   Transcript: ENST00000523686
Sequence length 129
Comment pep:known chromosome:GRCh38:8:68331222:68448010:1 gene:ENSG00000165084 transcript:ENST00000523686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASHPQTRIQAYLEKNKIGPLFEELMTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLS
GSAALWAESEKSESKGTRRDFRSYDKPWQLNAKKPKKSKSDLAVSNISPPSPDSKSCKEV
SYSNAIQSM
Download sequence
Identical sequences A0A2J8KZU7
ENSP00000429102 ENSP00000429102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]