SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429305 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429305
Domain Number 1 Region: 39-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 2 Region: 1-38
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429305   Gene: ENSG00000147650   Transcript: ENST00000523007
Sequence length 201
Comment pep:putative chromosome:GRCh38:8:104491418:104497605:-1 gene:ENSG00000147650 transcript:ENST00000523007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCQKEEFPCSRNGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNNRCVFESWVCD
SQDDCGDGSDEENCPVIVPTRVITAAVIGSLICGLLLVIALGCTCKLYSLRMFERRSFET
QLSRVEAELLRREAPPSYGQLIAQGLIPPVEDFPVCSPNQASVLENLRLAVRSQLGFTSV
RLPMAGRSSNIWNRIFNFARS
Download sequence
Identical sequences A0A2J8PMW7 A0A2J8UFS4
ENSP00000429305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]