SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429315 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000429315
Domain Number - Region: 204-274
Classification Level Classification E-value
Superfamily Globin-like 0.00012
Family Globins 0.011
Further Details:      
 
Domain Number - Region: 47-79
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.00053
Family Calpain large subunit, catalytic domain (domain II) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429315   Gene: ENSG00000118492   Transcript: ENST00000480328
Sequence length 714
Comment pep:known chromosome:GRCh38:6:146716883:146815459:1 gene:ENSG00000118492 transcript:ENST00000480328 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XTDEQTDFGLGDAHQSDGLNLEREIVSQTTATQEKSQEELPTTNNSVSKEIWLDFEDFCV
CFQNIYIFHKPSSYCLNFQKSEFKFSEERVSYYLFVDSLKPIELLVCFSALVRWGEYGAL
TKDSPPIEPGLLTAETFSWKSLKPGSLVLKIHTYATKATVVRLPVGRHMLLFNAYSPVGH
SIHICSMVSFVIGDEHVVLPNFEPESCRFTEQSLLIMKAIGNVIANFKDKGKLSAALKDL
QTAHYPVPFHDKELTAQHFRVFHLSLWRLMKKVQITKPPPNFKFAFRAMVLDLELLNSSL
EEVSLVEWLDVKYCMPTSDKEYSAEEVAAAIKIQAMWRGTYVRLLMKARIPDTKENISVA
DTLQKVWAVLEMNLEQYAVSLLRLMFKSKCKSLESYPCYQDEETKIAFADYTVTYQEQPP
NSWFIVFRETFLVHQDMILVPKVYTTLPICILHIVNNDTMEQVPKVFQKVVPYLYTKNKK
GYTFVAEAFTGDTYVAASRWKLRLIGSSAPLPCLSRDSPCNSFAIKEIRDYYIPNDKKIL
FRYSVKVLTPQPATIQVRTSKPDAFIKLQVLENEETMVSSTGKGQAIIPAFHFLKSEKGL
SSQSYGERHEELINLGSPDSHTISEGQKSSVTSKTTRKGKEKSSEKEKTAKEKQAPRFEP
QISTVHPQQEDPNKPYWILRLLRLVCITLAGSLRKHLMLRVRLYLKAKLNQKKK
Download sequence
Identical sequences H0YBE5
ENSP00000429315 ENSP00000429315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]