SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429746 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429746
Domain Number 1 Region: 103-201
Classification Level Classification E-value
Superfamily LCCL domain 4.18e-30
Family LCCL domain 0.0011
Further Details:      
 
Domain Number 2 Region: 205-309
Classification Level Classification E-value
Superfamily LCCL domain 9.94e-29
Family LCCL domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429746   Gene: ENSG00000121005   Transcript: ENST00000517786
Sequence length 314
Comment pep:putative chromosome:GRCh38:8:75000174:75032841:1 gene:ENSG00000121005 transcript:ENST00000517786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMNATHIVHSGVLALYVHIIHRGNWWGHAPYKHGRPCSACPPSFGGGCRENLCYKEGSD
RYYPPREEETNEIERQQSQVHDTHVRTRSDDSSRNEVISAQQMSQIVSCEVRLRDQCKGT
TCNRYECPAGCLDSKAKVIGSVHYEMQSSICRAAIHYGIIDNDGGWVDITRQGRKHYFIK
SNRNGIQTIGKYQSANSFTVSKVTVQAVTCETTVEQLCPFHKPASHCPRVYCPRNCMQAN
PHYARVIGTRVYSDLSSICRAAVHAGVVRNHGGYVDVMPVDKRKTYIASFQNGIFSESLQ
NPPGGKAFRVFAVV
Download sequence
Identical sequences ENSP00000429746 ENSP00000429746 NP_001273706.1.87134 NP_001273706.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]