SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429777 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000429777
Domain Number - Region: 69-165
Classification Level Classification E-value
Superfamily Rhomboid-like 0.0628
Family Rhomboid-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429777   Gene: ENSG00000145817   Transcript: ENST00000519064
Sequence length 177
Comment pep:known chromosome:GRCh38:5:144160478:144170635:-1 gene:ENSG00000145817 transcript:ENST00000519064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQPQQPYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLEELGINFDHIWQKTLTVLHPL
KVADGSIMNETDLAGPMVFCLAFGATLLLAGKIQFGYVYGISAIGCLGMFCLLNLMSMTG
VSFGCVASVLGYCLLPMILLSSFAVIFSLQGMVGIILTAGIIGWCSFSASKIFISAL
Download sequence
Identical sequences A0A2J8NJ33 A0A2J8VNV0 E5RHH4
ENSP00000429777 ENSP00000429777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]