SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429792 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429792
Domain Number 1 Region: 22-74
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000000000523
Family Hairy Orange domain 0.0000529
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429792   Gene: ENSG00000164683   Transcript: ENST00000523976
Sequence length 214
Comment pep:putative chromosome:GRCh38:8:79764720:79766475:-1 gene:ENSG00000164683 transcript:ENST00000523976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLEERNVFWLSKGNLTGDQGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPL
RVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASP
TEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLLSSVASLSAFPFSFGS
FHLLSPNALSPSAPTQAANLGKPYRPWGTEIGAF
Download sequence
Identical sequences B4DEI9
NP_001269780.1.87134 NP_001269780.1.92137 ENSP00000429792 ENSP00000429792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]