SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429833 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429833
Domain Number 1 Region: 68-120
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000445
Family Hepsin, N-terminal domain 0.039
Further Details:      
 
Domain Number 2 Region: 21-60
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000419
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429833   Gene: ENSG00000137648   Transcript: ENST00000517544
Sequence length 148
Comment pep:putative chromosome:GRCh38:11:118099043:118108223:1 gene:ENSG00000137648 transcript:ENST00000517544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XPIIIALLSLASIIIVVVLIKVILDKYYFLCGQPLHFIPRKQLCDGELDCPLGEDEEHCV
KSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETACRQMGYSSKPTFRA
VEIGPDQDLDVVEITENSQELRMRNSSG
Download sequence
Identical sequences H0YBM5
ENSP00000429833 ENSP00000429833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]