SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000429886 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000429886
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily UBC-like 1.07e-30
Family UBC-related 0.00000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000429886   Gene: ENSG00000169139   Transcript: ENST00000517630
Sequence length 105
Comment pep:putative chromosome:GRCh38:8:48008451:48060897:1 gene:ENSG00000169139 transcript:ENST00000517630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLTRWTGMIIGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDA
RSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
Download sequence
Identical sequences A0A2J8JMM7 A0A2J8UN03 G3V113 L5MG08
ENSP00000428818 ENSP00000429419 ENSP00000429886 XP_005251357.1.92137 XP_005613235.1.31192 XP_005638012.1.84170 XP_005876708.1.60319 XP_005961310.1.78601 XP_006170507.1.99106 XP_006170508.1.99106 XP_006754352.1.95426 XP_007106164.1.24612 XP_007168686.1.59432 XP_007998761.1.81039 XP_008975131.1.60992 XP_009453576.2.37143 XP_010946576.1.22495 XP_010986435.1.51371 XP_011801077.1.43180 XP_011801079.1.43180 XP_011825854.1.47321 XP_011825861.1.47321 XP_011825870.1.47321 XP_011825880.1.47321 XP_012578559.1.23501 XP_012905250.1.14098 XP_014309158.1.53796 XP_014309159.1.53796 XP_014309160.1.53796 XP_014309161.1.53796 XP_014407666.1.101512 XP_014440484.1.99106 XP_014643520.1.5094 XP_014700356.1.49734 XP_015095046.1.17985 XP_018887966.1.27298 XP_019284435.1.44245 XP_019678191.1.62641 ENSP00000428818 ENSP00000429419 ENSP00000429886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]