SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430031 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430031
Domain Number 1 Region: 210-271,317-408,436-588
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.18e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000486
Further Details:      
 
Domain Number 2 Region: 566-697
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.89e-33
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000568
Further Details:      
 
Domain Number 3 Region: 114-206
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.1e-25
Family Thioltransferase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430031   Gene: ENSG00000197763   Transcript: ENST00000524230
Sequence length 698
Comment pep:putative chromosome:GRCh38:3:126607052:126655155:-1 gene:ENSG00000197763 transcript:ENST00000524230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVGGRGERLPRGFARVVRVASEGSVRRPSGPVPAPQPPAFRFVSRPGRARSESETLERSP
PQSPGPGKAGDAPNRRSGHVRGARVLSPPGRRARLSSPGPSRSSEAREELRRHLVGLIER
SRVVIFSKSYCPHSTRVKELFSSLGVECNVLELDQVDDGARVQEVLSEITNQKTVPNIFV
NKVHVGGCDQTFQAYQSGLLQKLLQEDLAYDYDLIIIGGGSGGLSCAKEAAILGKKVMVL
DFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGQALCDSRKFGWEYNQQVRHNWETM
TKAIQNHISSLNWGYRLSLREKAVAYVNSYGEFVEHHKIKATNKKGQETYYTAAQFVIAT
GERPRYLGIQGDKEYCITSDDLFSLPYCPGKTLVVGASYVALECAGFLAGFGLDVTVMVR
SILLRGFDQEMAEKVGSYMEQHGVKFLRKFIPVMVQQLEKGSPGKLKVLAKSTEGTETIE
GVYNTVLLAIGRDSCTRKIGLEKIGVKINEKSGKIPVNDVEQTNVPYVYAVGDILEDKPE
LTPVAIQSGKLLAQRLFGASLEKCDYINVPTTVFTPLEYGCCGLSEEKAIEVYKKENLEI
YHTLFWPLEWTVAGRENNTCYAKIICNKFDHDRVIGFHILGPNAGEVTQGFAAAMKCGLT
KQLLDDTIGIHPTCGEVFTTLEITKSSGLDITQKGCUG
Download sequence
Identical sequences ENSP00000429584 ENSP00000430031 ENSP00000430031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]