SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430043 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430043
Domain Number 1 Region: 38-106
Classification Level Classification E-value
Superfamily Sec7 domain 0.00000000000000589
Family Sec7 domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430043   Gene: ENSG00000156011   Transcript: ENST00000517971
Sequence length 113
Comment pep:known chromosome:GRCh38:8:18799298:18808867:-1 gene:ENSG00000156011 transcript:ENST00000517971 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MGSSWCLYGCCNAGVKTTRLEAHSEMGSTEILEKETPENLSNGTSSNVEAAKRLAKRLYQ
LDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDFTGMTLDQSLRKMNLHCQVFL
Download sequence
Identical sequences A0A2J8X4E2 E5RH02
ENSP00000430043 ENSP00000430043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]