SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430086 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000430086
Domain Number - Region: 24-91
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00523
Family Rhomboid-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430086   Gene: ENSG00000136986   Transcript: ENST00000519018
Sequence length 151
Comment pep:putative chromosome:GRCh38:8:123015442:123025650:-1 gene:ENSG00000136986 transcript:ENST00000519018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDMIVSFWFGTRFKACYLPWVIL
GFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFLSTPQFLYRWLPSRRGGVSGF
GVPPASMRRAADQNGGGGRHNWGQGFRLGDQ
Download sequence
Identical sequences A0A2J8PNH3 A0A2J8X2U1 E5RGY0 I3L902
XP_006716720.1.92137 XP_011515601.1.92137 XP_015341915.1.40921 XP_019787615.1.83887 XP_020012091.1.5219 XP_020734692.1.74333 XP_020944327.1.46622 XP_020944328.1.46622 XP_020944329.1.46622 ENSP00000429199 ENSP00000430086 ENSP00000429199 ENSP00000430086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]