SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430698 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430698
Domain Number 1 Region: 20-318
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 7.96e-21
Family Rhodopsin-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430698   Gene: ENSG00000179921   Transcript: ENST00000479077
Sequence length 330
Comment pep:known chromosome:GRCh38:2:218259496:218263859:1 gene:ENSG00000179921 transcript:ENST00000479077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLA
GLLTGLALPTLPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQP
PGSIRLALLLTWAGPLLFASLPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGA
AAFLSVRVLATAHRQLQDICRLERAVCRDEPSALARALTWRQARAQAGAMLLFGLCWGPY
VATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQ
GLWGRASRDSPGPSIAYHPSSQSSVDLDLN
Download sequence
Identical sequences Q8TDU6
ENSP00000428824 gi|116284382|ref|NP_001070662.1| gi|116284384|ref|NP_001070659.1| gi|24850109|ref|NP_733800.1| ENSP00000428824 ENSP00000430202 ENSP00000430698 ENSP00000430886 9606.ENSP00000397905 NP_001070659.1.87134 NP_001070659.1.92137 NP_001070662.1.87134 NP_001070662.1.92137 NP_001308879.1.87134 NP_001308879.1.92137 NP_733800.1.87134 NP_733800.1.92137 XP_011509045.1.92137 XP_016858956.1.92137 XP_016858957.1.92137 XP_016858958.1.92137 ENSP00000428824 ENSP00000430202 ENSP00000430698 ENSP00000430886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]