SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430727 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430727
Domain Number 1 Region: 42-241
Classification Level Classification E-value
Superfamily Nicotinic receptor ligand binding domain-like 4.45e-55
Family Nicotinic receptor ligand binding domain-like 0.002
Further Details:      
 
Domain Number 2 Region: 243-278
Classification Level Classification E-value
Superfamily Neurotransmitter-gated ion-channel transmembrane pore 0.000000000445
Family Neurotransmitter-gated ion-channel transmembrane pore 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430727   Gene: ENSG00000094755   Transcript: ENST00000519385
Sequence length 289
Comment pep:putative chromosome:GRCh38:5:170783725:170812498:1 gene:ENSG00000094755 transcript:ENST00000519385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNYSLHLAFVCLSLFTERMCIQGSQFNVEVGRSDKLSLPGFENLTAGYNKFLRPNFGGEP
VQIALTLDIASISSISESNMDYTATIYLRQRWMDQRLVFEGNKSFTLDARLVEFLWVPDT
YIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVACNMDLSKYPMDTQTCKLQLES
WGYDGNDVEFTWLRGNDSVRGLEHLRLAQYTIERYFTLVTRSQQETGNYTRLVLQFELRR
NVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGDNKGSRRSQYY
Download sequence
Identical sequences E7EWG0
NP_001278914.1.87134 NP_001278914.1.92137 ENSP00000430727 ENSP00000430727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]