SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000430744 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000430744
Domain Number 1 Region: 7-161
Classification Level Classification E-value
Superfamily Sec7 domain 1.83e-53
Family Sec7 domain 0.0000846
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000430744   Gene: ENSG00000156011   Transcript: ENST00000520858
Sequence length 165
Comment pep:putative chromosome:GRCh38:8:18762885:18804829:-1 gene:ENSG00000156011 transcript:ENST00000520858 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XETPENLSNGTSSNVEAAKRLAKRLYQLDRFKRSDVAKHLGKNNEFSKLVAEEYLKFFDF
TGMTLDQSLRYFFKAFSLVGETQERERVLIHFSNRYFYCNPDTIASQDGVHCLTCAIMLL
NTDLHGHNIGKKMTCQEFIANLQGVNEGVDFSKDLLKVLWDWRRC
Download sequence
Identical sequences H0YC20
ENSP00000430744 ENSP00000430744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]