SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431067 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431067
Domain Number 1 Region: 85-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.83e-26
Family Skp1 dimerisation domain-like 0.0000187
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily POZ domain 1.92e-25
Family BTB/POZ domain 0.0000341
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431067   Gene: ENSG00000113558   Transcript: ENST00000521216
Sequence length 163
Comment pep:novel chromosome:GRCh38:5:134157392:134176920:-1 gene:ENSG00000113558 transcript:ENST00000521216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKYTLRKTTVSLQAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
Download sequence
Identical sequences E5RJR5
ENSP00000429961 ENSP00000431067 ENSP00000431067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]