SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431294 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431294
Domain Number 1 Region: 12-70
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431294   Gene: ENSG00000198431   Transcript: ENST00000526266
Sequence length 70
Comment pep:known chromosome:GRCh38:12:104286002:104315826:1 gene:ENSG00000198431 transcript:ENST00000526266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCV
NVGCIPKKLM
Download sequence
Identical sequences E9PLT3
ENSP00000431294 ENSP00000431294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]