SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431326 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431326
Domain Number 1 Region: 24-83
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000000235
Family Plexin repeat 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSP00000431326
Domain Number - Region: 96-141
Classification Level Classification E-value
Superfamily Integrin domains 0.0267
Family Integrin domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431326   Gene: ENSG00000150093   Transcript: ENST00000534049
Sequence length 143
Comment pep:known chromosome:GRCh38:10:32928212:32992463:-1 gene:ENSG00000150093 transcript:ENST00000534049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPI
Download sequence
Identical sequences E9PLR6
ENSP00000431326 ENSP00000431326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]