SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431712 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431712
Domain Number 1 Region: 20-140
Classification Level Classification E-value
Superfamily Lipocalins 5.69e-31
Family Retinol binding protein-like 0.0000738
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431712   Gene: ENSG00000122133   Transcript: ENST00000371768
Sequence length 169
Comment pep:known chromosome:GRCh38:9:135561756:135566776:1 gene:ENSG00000122133 transcript:ENST00000371768 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVH
ITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNF
LFLCLQDTTTPIQSMMCQYLESWWRTMRSCRDSSGLSGPCPGTYGTCWT
Download sequence
Identical sequences F2Z349
ENSP00000431712 ENSP00000431712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]