SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431753 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000431753
Domain Number 1 Region: 42-172
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 7.85e-33
Family Arylsulfatase 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431753   Gene: ENSG00000137573   Transcript: ENST00000525999
Sequence length 172
Comment pep:known chromosome:GRCh38:8:69563862:69586460:1 gene:ENSG00000137573 transcript:ENST00000525999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYSCCALVLAVLGTELLGSLCSTVRSPRFRGRIQQERKNIRPNIILVLTDDQDVELGSL
QVMNKTRKIMEHGGATFINAFVTTPMCCPSRSSMLTGKYVHNHNVYTNNENCSSPSWQAM
HEPRTFAVYLNNTGYRTAFFGKYLNEYNGSYIPPGWREWLGLIKNSRFYNYT
Download sequence
Identical sequences A0A2J8M9J9 A0A2J8RZM9 E9PJL8
ENSP00000431753 ENSP00000431753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]