SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000431933 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000431933
Domain Number - Region: 96-133
Classification Level Classification E-value
Superfamily Prefoldin 0.0243
Family Prefoldin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000431933   Gene: ENSG00000104529   Transcript: ENST00000533749
Sequence length 137
Comment pep:putative chromosome:GRCh38:8:143581079:143599541:-1 gene:ENSG00000104529 transcript:ENST00000533749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPACTRSQERPASRKMATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGAS
VILRDIARARENIQKSLAGSSGPGASSGTSGDHGELVVRIASLEVENQSLRGVVQELQQA
ISKLEARLNVLEKSSPG
Download sequence
Identical sequences E9PIZ1
ENSP00000431933 ENSP00000431933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]