SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000432555 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432555
Domain Number 1 Region: 28-113
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 1.74e-26
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.004
Further Details:      
 
Domain Number 2 Region: 2-27
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0000000248
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432555   Gene: ENSG00000167325   Transcript: ENST00000528442
Sequence length 130
Comment pep:known chromosome:GRCh38:11:4111975:4123385:1 gene:ENSG00000167325 transcript:ENST00000528442 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
XTYNLLSERWFTHASPTLFNAGTNRPQLSSCFLLSMKDDSIEGIYDTLKQCALISKSAGG
IGVAVSCIRATGSYIAGTNGNSNGLVPMLRVYNNTARYVDQGGNKRIMIYLPLASWGICY
LPGALAFRHL
Download sequence
Identical sequences H0YCY7
ENSP00000432555 ENSP00000432555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]