SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000432737 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000432737
Domain Number 1 Region: 13-62
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000561
Family FAD-linked reductases, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000432737   Gene: ENSG00000148832   Transcript: ENST00000476834
Sequence length 69
Comment pep:known chromosome:GRCh38:10:133379287:133391624:1 gene:ENSG00000148832 transcript:ENST00000476834 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MESTGSVGEAPGGPRVLVVGGGIAGLGAAQRLCGHSAFPHLRVLEATARAGGRIRSERCF
GAIKDSQTA
Download sequence
Identical sequences ENSP00000357527 ENSP00000432517 ENSP00000432737 ENSP00000434550 ENSP00000432517 ENSP00000432737 ENSP00000434550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]